SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013823 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013823
Domain Number 1 Region: 414-528,648-785
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.25e-67
Family Phosphate binding protein-like 0.000000106
Further Details:      
 
Domain Number 2 Region: 33-392
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.01e-36
Family L-arabinose binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013823   Gene: ENSOGAG00000015433   Transcript: ENSOGAT00000015440
Sequence length 977
Comment pep:known_by_projection scaffold:OtoGar3:GL873671.1:306632:373385:-1 gene:ENSOGAG00000015433 transcript:ENSOGAT00000015440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYPGP
ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
RVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS
WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLD
PFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPV
GGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLAD
QTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFL
LESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKR
KWWEGGRCPKEEDHRAKGLGMENIGGIFVVLICGLIIAVFVAVMEFIWSTRRSAESEELP
FSLLTSCLSSPSSLRLPAFSPQPWASLKEPLSASCLAFSRTSLQQVFPFLSHPHLSSLYW
SQAISIYMCCHLKRSLVPHLSSQSPLISPLPFIVLKELHLPAASSFFPPINSWPAPVWLL
SPPHSTEATLVTSTLHF
Download sequence
Identical sequences H0XD91
ENSOGAP00000013823 ENSOGAP00000013823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]