SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014293 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014293
Domain Number 1 Region: 45-284
Classification Level Classification E-value
Superfamily PLP-binding barrel 8.22e-65
Family Alanine racemase-like, N-terminal domain 0.0000000467
Further Details:      
 
Domain Number 2 Region: 249-412
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.05e-31
Family Eukaryotic ODC-like 0.000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014293   Gene: ENSOGAG00000015963   Transcript: ENSOGAT00000015966
Sequence length 460
Comment pep:known_by_projection scaffold:OtoGar3:GL873723.1:907806:950893:1 gene:ENSOGAG00000015963 transcript:ENSOGAT00000015966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSESDFVMVEEGFSTRDLLEELTLGASQATTGKVAAFFVADLGAVVRKHFCFLKCL
PRVRPFYAVKCNSSPGVLKVLAELGLGFSCANKAEMELVQRIGVPASKIIYTNPCKQIVQ
IKYAAKHGIRLLSFDNEMELAKVVKSHPSAKMVLSIATDDSHSLSRLSLKFGASLKSCRH
LLENAKRSHMEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHRMHILDLGGGFP
GMEGDKVRFEEIASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKKEVLLD
QPGREEENGSAPKTIVYHLDEGVYGIFNSVLFDDICPTPTLQKKSSTEQPLYSSSLWGPA
ADGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGTGSLLGGTQACRITYAMSRMAWEALRG
QLLPAEQDEDAEGVCKPLSCGWEITDTLCVGPVFTPASIM
Download sequence
Identical sequences H0XEC7
ENSOGAP00000014293 NP_001280646.1.62490 XP_012667813.1.62490 ENSOGAP00000014293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]