SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014389 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014389
Domain Number 1 Region: 82-449
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.68e-116
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000000000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014389   Gene: ENSOGAG00000016071   Transcript: ENSOGAT00000016076
Sequence length 454
Comment pep:known_by_projection scaffold:OtoGar3:GL873752.1:59644:87915:-1 gene:ENSOGAG00000016071 transcript:ENSOGAT00000016076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAKWLSVKMAGAIAAARVWGPSRGLGQAALLALRRPGTRGLATSYPHRQQQQQFSSLDDK
PQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINSSEDPHLPQEKVLKLYKSMTL
LNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPL
ELFMAQCYGNVNDQGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRV
VICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGY
GIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEV
NYWDKQDHPISRLRHYLLSRGWWDDEQEKAWRKQSRKKVMEAFEQAERKLKPNPNLLFSD
VYQEMPAQLRKQQESLARHLQTYGEHYPLDHFEK
Download sequence
Identical sequences H0XEL1
ENSOGAP00000014389 ENSOGAP00000014389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]