SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014423 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014423
Domain Number 1 Region: 242-343
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.24e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 96-204
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.44e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.032
Further Details:      
 
Domain Number 3 Region: 15-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000093
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014423   Gene: ENSOGAG00000016112   Transcript: ENSOGAT00000016119
Sequence length 827
Comment pep:known_by_projection scaffold:OtoGar3:GL873600.1:6622636:6642443:1 gene:ENSOGAG00000016112 transcript:ENSOGAT00000016119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAQAAKAPAKCRISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNNNQSQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
DDQQLEEVPLYNDVMLPSPSEKLQNLNLAMSPLPASETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQPPSPSDGSTRQSSPEPTSPSEYCFYVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESGSSSPQSASPQGTIT
VFQQTQIEEPSVTATTNTATTDELKTVAKDALEDIKILIASPSPTHHVHKETTSATTSPC
SDTPSRTASPNRAGQGVIAQTEKSHPRSPNVLSVALSQRTTVTKEELNPKILALQNAQRK
RKMEHDGSLFQAVGIGTLLQQPDDRAAPTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLA
CRLLGQSMDESGLPQLTSYDCEVNAPVQGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences H0XEP0
ENSOGAP00000014423 ENSOGAP00000014423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]