SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014507 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014507
Domain Number 1 Region: 429-636
Classification Level Classification E-value
Superfamily Kelch motif 3.66e-66
Family Kelch motif 0.00000461
Further Details:      
 
Domain Number 2 Region: 343-471
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-35
Family Kelch motif 0.00021
Further Details:      
 
Domain Number 3 Region: 9-127
Classification Level Classification E-value
Superfamily POZ domain 2.08e-28
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014507   Gene: ENSOGAG00000016199   Transcript: ENSOGAT00000016207
Sequence length 642
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:8676454:8689888:1 gene:ENSOGAG00000016199 transcript:ENSOGAT00000016207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEI
FNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQV
CGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEV
MLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLLDGNLLDGQ
AEVFGSDDDHIQFVQKKPPRENGHKQISSSSTGCLSSPNATVQSPKHEWKIVASEKTSNN
TYLCLAVLDGIFCVIFLHGRNSPQSSPTNTPKLSKSLSFEMQPDDLVEKPMSPMQYARSG
LGTAEMNGKLIAAGGYNREECLRTVECYDPHTDHWSFIAPMRTPRARFQMAVLMGQLYVV
GGSNGHSDDLSCGEMYDPNIDDWIPIPELRTNRCNAGVCALNGKLYIVGGSDPYGQKGLK
NCDVFDPVTKSWTSCAPLNIRRHQSAVCELDGYLYIIGGAESWNCLNTVERYNPENNTWT
LIAPMNVARRGAGVAVLDGKLFVGGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAG
ITTVGNTIYAVGGFDGNEFLNTVEVYNLESNEWSPYTKIFQF
Download sequence
Identical sequences H0XEV9
ENSOGAP00000014507 XP_003785671.1.62490 ENSOGAP00000014507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]