SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014888 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014888
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 3.77e-166
Family Phosphoglycerate kinase 0.00000000000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014888   Gene: ENSOGAG00000016635   Transcript: ENSOGAT00000016638
Sequence length 417
Comment pep:known_by_projection scaffold:OtoGar3:GL873788.1:1036803:1038056:1 gene:ENSOGAG00000016635 transcript:ENSOGAT00000016638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSKKLTLDKVDVKGKRVVMRVDFNVPMKNNQITNNQRIKASLPSIKYCLDNGAKSVVL
MSHLGRPDGVPMPEKYSLEPVAAELKSLIGKDVTFLKDCVGPDVEKACANPNTGSVILLE
NLRFHVEEEGKGQDPSGKKIKAEPNQIEAFRASLSKLGDIYVNDAFGTAHRAHSSMVGVN
LPQKASGFLMKKELEYFGKALENPEKPFLAILGGAKVADKIQLIKNMLDKVSEMIVGGGM
AFTFLKVLNNMEIGASLFDAEGAAIVKDIMAKASSKNVNITFPVDFVTGDKFEENAQVGQ
ASLASGIPAGWMGLDCGPESNKKFAEIVARAKLIVWNGPLGVFEWDAFAKGTKTLMDDIV
KATSKGCVTIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNL
Download sequence
Identical sequences H0XFS9
ENSOGAP00000014888 ENSOGAP00000014888 XP_003803027.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]