SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015102 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015102
Domain Number 1 Region: 404-433,466-570,692-807
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5e-56
Family Phosphate binding protein-like 0.0000000789
Further Details:      
 
Domain Number 2 Region: 90-389
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.47e-22
Family L-arabinose binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015102   Gene: ENSOGAG00000016863   Transcript: ENSOGAT00000016870
Sequence length 1248
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:7025459:7035765:1 gene:ENSOGAG00000016863 transcript:ENSOGAT00000016870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPVLVSFQDLPVDMGGALGPALLLTSLLGAWAGPGPGQGTQAVTVAVVFGSSGPSQAQAR
ARLTPQSFLDLPLEIQPLTVGVNNTNPSSLLTQICGLLGAARVHGIVFEDNVDTEAVAQI
LDFISSQTHVPILSISGGSALVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAV
ITSLHPGHALFLKGVRAVADASHLSWRLLDVLTLELGPGGPRARTQHLLRQLDAPVFVAY
CSREEAEVLFAEAAQAGLVGPGHVWLVPNLALGSTDAPPATFPVGLISVVTESWRLSLRQ
KVRDGVAILAMGAHGYRRQYGSLPATAGDCRGHPGPVSPAREAFYRHLLNVTWEGRDFSF
SAGGYLVQPTMVVIALNRHRLWEMVGRWDHGVLYMKYPVWPRYSASLQPVVDSRHLTVAT
LEERPFVIVESPDPGTGGCVPNTVPCRRQSNHTFSSSDAPPYTKLCCKGFCIDILKKLAK
VVKFSYDLYLVTNGKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFV
ETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFMFEYFSPVSYNQNLT
RGKKSGGPSFTIGKSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANL
AAFMIQEQYIDTVSGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFN
QRSVEDALTSLKMGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDS
HWKRAIDLALLQFLGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMG
LALLVFAWEHLVYWKLRHSVPPTSQLDFLLAFSRGIYSCFNGVQSLASPPQPPSPDLTAS
SAQASVLKMLQAARDMVTTAGVSSSLDRATRTIENWGGSRRAPPPPSCPASQPGLGLRPP
TPSPPLELSPRSWEQAGGGRATLVRRAPHQPGRPPTSGPPQPDVSRVSRRPARAGHCGRH
LSASERRVLPERPLSPARCHYSSFPRADRSGRPFLPLFLEPSEPEDLPLLGPEQLARREA
LLRAAWARGSRPRHASLPSSVAEAFTRSSPRPACCASPTCARPDGRPACRSLAQAQSMQL
PSYREVCLGGVLAGPPAWQHAHHVCLHAHTHLPFCWGAVCSHLPPCASHGPWLTGAWGPV
GHRSRTLGLSTGYRDSGGLDEVSRVACGAQGFLGPCTWRRVCSLESEV
Download sequence
Identical sequences H0XGA6
ENSOGAP00000015102 ENSOGAP00000015102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]