SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015105 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015105
Domain Number 1 Region: 143-365
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.06e-55
Family C-terminal domain of adrenodoxin reductase-like 0.0000000103
Further Details:      
 
Domain Number 2 Region: 39-201
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2e-19
Family N-terminal domain of adrenodoxin reductase-like 0.00000465
Further Details:      
 
Domain Number 3 Region: 342-493
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000577
Family N-terminal domain of adrenodoxin reductase-like 0.000000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015105   Gene: ENSOGAG00000016869   Transcript: ENSOGAT00000016873
Sequence length 494
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:7008131:7018012:1 gene:ENSOGAG00000016869 transcript:ENSOGAT00000016873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPRCWFWWRWSAWPRTRPPFAGSTPTPGLLQQFSTQEKTPQICVVGSGPAGFYTAQHLL
KHHPQAQVDIYEKQFVPFGLVRFGVAPDHPEVKNVINTFTQTAHSDRCAFWGNVEVGRDV
TVPELQEAYHAVVLSYGAEDHQPLGIPGEELPGVLSARTFVGWYNGLPENRELTPDLSCD
TVVILGQGNVALDVARILLTPPEHLERTDITKAALEVLRQSQVKTVWIVGRRGPLQVAFT
IKELREMIQLPGTRPILDSENFLGLQDRIKEVPRPRKRLTELLLQTATQKPSGEETAHQA
LASRVWGLRFFRSPQQVLPSPDGRRVAGIRLAVTRLEGVGEATRAVPTGDTEDLPCGLVL
SSVGYKSRPIDPSVPFDPKLGVIPNTEGRVVDVPGLYCSGWVKRGPTGVIATTMSDSFLT
GQTLLQDLKAGLLPSGPRPGSVAIQTLLRSRGVRPVSFSDWEKLDAEEVARGQGAGKPRE
KLVDPREMLQLLGH
Download sequence
Identical sequences H0XGA9
XP_003786199.1.62490 ENSOGAP00000015105 ENSOGAP00000015105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]