SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015140 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015140
Domain Number 1 Region: 560-820
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.21e-81
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 224-328
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000542
Further Details:      
 
Domain Number 3 Region: 444-545
Classification Level Classification E-value
Superfamily SRCR-like 7.85e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000735
Further Details:      
 
Domain Number 4 Region: 333-434
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 5 Region: 115-212
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0038
Further Details:      
 
Domain Number 6 Region: 32-118
Classification Level Classification E-value
Superfamily Kringle-like 4.94e-16
Family Kringle modules 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015140   Gene: ENSOGAG00000016906   Transcript: ENSOGAT00000016913
Sequence length 821
Comment pep:known_by_projection scaffold:OtoGar3:GL873683.1:2410137:2479796:1 gene:ENSOGAG00000016906 transcript:ENSOGAT00000016913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSPLVLRPLRPPRPPRALPAQRLQAFQAGHTPRPYPGGCPSGEPWVNVTDFGAPCLRWA
EVPPFLERSPPGSWAQLRGQRHNFCRSPDSAGRPWCFYGNAYGKVDWGYCDCRRGSVRLH
GGKNEFDGTVEVCASGVWGTVFSSCWGDSNASVTCHQLQLGGKGIAKQTPFSGLGLIPIN
CSNVRCQGDEENIWLCEKDIWQGVCPQTMIAAVAISHCTGPVFPAVRLAGGRSVHEGRVE
LYHAGQWGTICDDQWDDADAEVICRQLGLSGIAKAWNQAYFGEGSGPVMLDEVRCTGNEL
SIEQCPKSSWGEHNCDHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDD
GWTELNTYVVCRQLGFKYGKQASANHFQESPGPIWLDDVSCSGKETSVLQCSRRQWGRHD
CSHREDVGISCYPGSDGHRLSLGFPIRLMDGETKKEGRVEVFINGQWGTICDDGWTDKDA
AVICRQLGYKGPARARSMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSED
AGVICDYFGKKASGNSNKESLSSVCGVRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSH
GDGRLLCGATLLSSCWVLTAAHCFKRYGNSTKNYAVRVGDYHTLVPEEFEEEIGIQQIVV
HQEYRPDSSDYDIALVRLQGPEEQCARFSSHVLPACLPLRRERPQKTASNCYITGWGDTG
RAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLQEHKRVDSCQGDSGGPLMCERA
GTSWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences H0XGE0
ENSOGAP00000015140 ENSOGAP00000015140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]