SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015143 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015143
Domain Number 1 Region: 9-302
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.63e-88
Family TK-like PP module 0.0000843
Further Details:      
 
Domain Number 2 Region: 297-478
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.55e-54
Family TK-like Pyr module 0.0021
Further Details:      
 
Domain Number 3 Region: 487-621
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.95e-30
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015143   Gene: ENSOGAG00000016911   Transcript: ENSOGAT00000016916
Sequence length 623
Comment pep:known_by_projection scaffold:OtoGar3:GL873551.1:2436874:2464027:-1 gene:ENSOGAG00000016911 transcript:ENSOGAT00000016916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKS
QDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLPEAELLNLRKISSDLDGHPVPKQAFTDV
ATGSLGQGLGAACGMAYTCKYFDKASYRVYCMLGDGELSEGSVWEAMAFAGIYKLDNLVA
ILDINRLGQSDPAPLQHQLDVYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIA
KTFKGRGITGVEDKESWHGKPLPKNMADQTIQEIYSQIQSKKKILATPPQEDAPSVDITN
IRMPTPPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEIFKKEHPDRFI
ECYIAEQNMVSIAVGCATRNRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVS
IGEDGPSQMALEDLAMFRAVPMSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAII
YNNNEDFQVGQAKVVLKSKDDQVTVIGAGVTLHEALAAAELLKKEKINIRVLDPFTIKPL
DRKLILDSARATKGRILTVEDHYNEGGIGEAVCTAVVGEPGITVTRLAVTQVPRSGKPAE
LLKMFGIDKDAIVQAVRGLVNKA
Download sequence
Identical sequences H0XGE2
ENSOGAP00000015143 XP_003789434.1.62490 ENSOGAP00000015143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]