SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015295 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015295
Domain Number 1 Region: 2-428
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-130
Family ALDH-like 0.000000000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015295   Gene: ENSOGAG00000017078   Transcript: ENSOGAT00000017084
Sequence length 485
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:1871732:1903515:1 gene:ENSOGAG00000017078 transcript:ENSOGAT00000017084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREVQRVRQAFRSGRSRPLRFRLQQLEALRRMVLEREKDILAAIGADLCKSEFNAYSQE
VITVLGEIDFMLENLPEWITAKSVKKNLLTMLDEAYVQPEPLGVVLIIGAWNYPFVLTIH
PLVGAIAAGNAVIIKPSELSENTATILAKLLPQYLDQDLYAVVNGGVKETTELLKQRFDH
ILYTGSAAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQDQIVQKIKETVKEFYGENIKESPDYERIINPRHFKRILSLLEGQKI
AFGGETDEDTRYIAPTILTDVDPETKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
LYVFSHNSKLIKRMIDETSSGGVTGNDVIMHFILNSLPFGGVGSSGMGAYHGKYSFDTFS
HQRPCLLKSLKGEAANKLRYPPNSQSKVDWGKFFFLKRFNKGKLSLLLLAFLGVLAAVLI
KAGYY
Download sequence
Identical sequences H0XGS8
ENSOGAP00000015295 XP_003791110.1.62490 ENSOGAP00000015295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]