SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015296 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015296
Domain Number 1 Region: 5-436
Classification Level Classification E-value
Superfamily ALDH-like 3.53e-134
Family ALDH-like 0.00000000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015296   Gene: ENSOGAG00000017080   Transcript: ENSOGAT00000017085
Sequence length 453
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:1930698:1937557:-1 gene:ENSOGAG00000017080 transcript:ENSOGAT00000017085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKISDTVKRARAAFNSGKTRPLQFRVQQLEALRRMIQEREQDIAGALAADLHKNEWNSY
YEEVVYVLEEIDYMIQKLPEWAADEPVEKTAQTQQDESYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNAVVLKPSELSENTANLLATLIPQYLDKDLFPVINGGVPETTEVLKER
FDHILYTGSTGVGKIVMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNHIVEKLKKSLQEFYGEDARKSQDYGRIINARHFQRVMGLIEG
QKVAHGGTGDAAARYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEDAIQFINQREK
PLALYVFSSNDKVIKKMIAETSSGGVTANDVIVHITVHTLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRSLLNDEVLKVRYPPSQAKVRGE
Download sequence
Identical sequences H0XGS9
ENSOGAP00000015296 ENSOGAP00000015296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]