SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015417 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015417
Domain Number 1 Region: 166-423
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.07e-80
Family Eukaryotic proteases 0.00000000379
Further Details:      
 
Domain Number 2 Region: 51-157
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-33
Family Kringle modules 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015417   Gene: ENSOGAG00000017210   Transcript: ENSOGAT00000017216
Sequence length 429
Comment pep:known_by_projection scaffold:OtoGar3:GL873527.1:11675320:11679869:-1 gene:ENSOGAG00000017210 transcript:ENSOGAT00000017216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVPLAFLLLCVLVVSDSKGSHDLRGESDASNCGCLNGGTCVTYKHFSNIRRCICPKKFQ
GEHCEIDTAKTCYEGNGHSYRGKANTDVMGRSCLAWNSATVLLKTYHAHRPDALQLGLGK
HNYCRNPDNQRRPWCYVQVGLKQVIQECMVSDCSGKRPFPSEKSEFQCGQKALRPRFKIV
GGEFTTIENQPWFAAIYKRNRGGSVSYVCGGSLISPCWVVSATHCFINYPQKDDYIVYLG
RSRLNSITPGEMKFEVEQLILHEGYSAETLAHHNDIALLKIRSSEGQCAQPSRSIQTICL
PPMYGDANFGTSCEITGFGKESSNDYRYAEQLKMTVVKLVSHQECQQPHYYASEVTTKML
CAADPQWETDSCQGDSGGPLVCSTQGRLTLTGIVSWGRGCALKDKPGVYTRVSRFLPWIR
THMGKENGL
Download sequence
Identical sequences H0XH31
ENSOGAP00000015417 ENSOGAP00000015417 XP_003783593.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]