SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015466 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015466
Domain Number 1 Region: 11-278
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.86e-92
Family TK-like PP module 0.0000926
Further Details:      
 
Domain Number 2 Region: 300-484
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.5e-54
Family TK-like Pyr module 0.0042
Further Details:      
 
Domain Number 3 Region: 491-624
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.54e-31
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015466   Gene: ENSOGAG00000006953   Transcript: ENSOGAT00000006956
Sequence length 626
Comment pep:known_by_projection scaffold:OtoGar3:GL873604.1:7374862:7376742:-1 gene:ENSOGAG00000006953 transcript:ENSOGAT00000006956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMADDAKPDAKTLQALRDAANRLRIHSIRATCASSSGHPTSCCSAAEIMSVLFFHTMRYK
RTDPQHPDNDRFVLSKGHAAPVLYAAWAEVGDISESDLLNLRKIHCDLEGHPTPRLPFVD
VATGSLGQGLGAACGMAYTGKYFDKASYRVFCLMGDGESSEGSVWEALAFASHYSLDNLV
AVFDVNRLGQSGTAPLEHCTDIYQNRCEAFGWNTYIVDGHDVEALCQAFSQAAQVKNKPT
AIVAKTFKGRGIPNIEDAENWHGKPVPKERAEAIIKLIQSQIQTQGNPISKPPVEDSPQI
SITNIQMTSPPAYKMGDKIATQKAYGLALAKLGHENKRVIVLDSDTKNPTFSEIFKKEHP
ERFIECFIPEQNMVSVALGCATRGRTIVFANTFSAFFTRAFDQIRMGAISQTNINLIGSH
CGVSIGEDGPSQMALEDLAMFRSIPNCTVFYPSDALSTEHAVYLAANTKGMCFIRTSQPE
TEVIYTAQEKFEIGQAKVVLHSDNDKVTVIGAGITLHEALAAADNLSQQGIAIRVIDPFT
IKPLDAATIISSAKATGGRVITVEDHHKEGGLGEAVCAAVSREPDILVHQLAVSGLPQSG
KPGELLDMFGISAGHIVSAVRNILMN
Download sequence
Identical sequences H0XH76
ENSOGAP00000015466 ENSOGAP00000015466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]