SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015636 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015636
Domain Number 1 Region: 10-124
Classification Level Classification E-value
Superfamily POZ domain 8.11e-31
Family BTB/POZ domain 0.00094
Further Details:      
 
Domain Number 2 Region: 397-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000237
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 376-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000018
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015636   Gene: ENSOGAG00000027115   Transcript: ENSOGAT00000026284
Sequence length 505
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:19274437:19285449:-1 gene:ENSOGAG00000027115 transcript:ENSOGAT00000026284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTMEKGGNIQLEIPDFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFR
DHMSLNEMSTVSISVIKNPTVFEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIIDKC
TQILEGIHFKINVAEVEAELSQTRTKHQERPPESHRVTPNLNRSLSPRHNTPKGNRRGQV
SAVLDIRELSPPEESTSPQIIEQSSDVESREPILRINRAGQWYVETGVADRGGRSDDEVR
VLGAVHIKTENLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQENYTLGSSGAKV
ARPTSSEVDRFSPSGSVVPLTERHRARSESPGRMDEPKQPSSQVEESPMMGVSGYVEYLR
EQEVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEY
HIRKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGYIPLEGPHSISPETTVTSRGQTEE
ESPSQEETVAPGETAPGSVSTTGPD
Download sequence
Identical sequences H0XHP6
ENSOGAP00000015636 ENSOGAP00000015636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]