SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015803 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015803
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Ribosomal protein S2 0.0000000000641
Family Ribosomal protein S2 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015803   Gene: ENSOGAG00000024451   Transcript: ENSOGAT00000028616
Sequence length 198
Comment pep:novel scaffold:OtoGar3:GL873748.1:155663:158198:1 gene:ENSOGAG00000024451 transcript:ENSOGAT00000028616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVLKFAAAIGATPIAGCFIPGTFTNHSQAAFWEPCLLVDTDPEPSHVNLPTTALCKPASL
HHGGIILCSNKGAHSGLTWWRLAWEVLHVAPSPGKYPWEVLSALYFYRDTEEIEKEEQAA
AEKAVPKEEFQGDWTAPAPERTATQPVVAGWSELQVPSEPRQRVPTEDRSSTPSATEDRA
VSPLVWAAVWVGQLLECR
Download sequence
Identical sequences H0XI63
ENSOGAP00000015803 ENSOGAP00000015803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]