SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015874 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015874
Domain Number 1 Region: 15-132
Classification Level Classification E-value
Superfamily POZ domain 1.83e-29
Family BTB/POZ domain 0.0000696
Further Details:      
 
Domain Number 2 Region: 515-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-20
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 556-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015874   Gene: ENSOGAG00000027908   Transcript: ENSOGAT00000027524
Sequence length 625
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:12373074:12376895:-1 gene:ENSOGAG00000027908 transcript:ENSOGAT00000027524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSTATTEGALGYVREFTRHSSDVLGNLNQLRLRGILTDVTLLVGGQPLRAHKAVLIACS
GFFYSIFRGRAGVGVDVLSLPGGPEARGFTTLLDFMYTSRLRLSPTTAPAVLAAATYLQM
EHVVQACHRFIQARDSVFSVGEVMPQVSRTRQKLRNGTNVHHTFHSYEPLGISMQPLEAE
PPLPPTAPPPGSPRRSEGHPDPPTESRSCSQGPPSPASPDPKACNWKKYKYIVLNSQASQ
AGSLVGEKSSGQPCSQAKLPSGDEACQETERWAWVSEILAHLREISQRPGLFSGPRLSPT
TATIQFNCGTPANNPHLLTAQAQKTTGSPSEQAHPSPSKIAFLLWLLQASLGQKTSGEAH
SRSSVGRVPATYTKVGRFEHSQGQAYLPLGLSGLPRNCQGLSGRLLSRMEEKWKCSSTSR
GLHLPPPLLNRRLEALVSNCGCHYSLPFPGSEFFSCQNCEAVAGCSSGLDLLAEDKPYKC
QLCQSAFRYKGNLASHRTVHTGEKPYHCSVCGARFNRPANLKTHSRIHSGEKPYKCETCG
SRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQTLKSHVRIHTGEKPYHCDPCGLHFR
HKSQLRLHLRQKHGAATNTKVHYHI
Download sequence
Identical sequences H0XID4
ENSOGAP00000015874 ENSOGAP00000015874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]