SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016077 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016077
Domain Number 1 Region: 10-322
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.67e-59
Family Quinoprotein alcohol dehydrogenase-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016077   Gene: ENSOGAG00000033928   Transcript: ENSOGAT00000031127
Sequence length 328
Comment pep:known_by_projection scaffold:OtoGar3:GL873563.1:8448497:8451308:1 gene:ENSOGAG00000033928 transcript:ENSOGAT00000031127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSTKQVNALEITPDRSMIA
AAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRN
LQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHI
DPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATC
SADQTCKIWRTSNFSLMTELSIRSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWC
VETGEIKREYGGHQKAVVCLAFNDSVLG
Download sequence
Identical sequences H0XIY7
ENSOGAP00000016077 ENSOGAP00000016077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]