SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016103 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016103
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily FKBP-like 1.45e-38
Family FKBP immunophilin/proline isomerase 0.000000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016103   Gene: ENSOGAG00000029092   Transcript: ENSOGAT00000028688
Sequence length 108
Comment pep:known_by_projection scaffold:OtoGar3:GL873541.1:15140873:15153720:1 gene:ENSOGAG00000029092 transcript:ENSOGAT00000028688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EDGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Download sequence
Identical sequences H0XJ13
ENSOGAP00000016103 ENSOGAP00000016103 XP_003787481.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]