SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016121 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016121
Domain Number 1 Region: 237-263,305-510
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.15e-60
Family Voltage-gated potassium channels 0.00068
Further Details:      
 
Domain Number 2 Region: 109-206
Classification Level Classification E-value
Superfamily POZ domain 4.97e-26
Family Tetramerization domain of potassium channels 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016121   Gene: ENSOGAG00000029508   Transcript: ENSOGAT00000029296
Sequence length 605
Comment pep:known_by_projection scaffold:OtoGar3:GL873623.1:3629890:3631707:-1 gene:ENSOGAG00000029508 transcript:ENSOGAT00000029296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIALVPLENGGAMTVRARGEAETGCGQATGGALQCPPTVGLTDGPKEVAPTGHSLQRGA
DPGGRPLPPLPEELPPPRRPPPEDEEGEGHPGLDMAEDQALSAASLHHQRVLINISGLRF
ETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNV
SLDLFADEIRFYQLGDEAMQRFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSARA
IAIVSVLVILISIITFCMETLPEFRDERELLRHPPAPPQPPVPAPGANGSGVVAPPSGPT
VAPLLPRTLADPFFIVETTCVVWFTFELLVRFFACPSKAEFSRNIMNIIDVVAIFPYFIT
LGTELAEQQPGGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQAS
MRELGLLIFFLFIGVILFSSAVYFAEADSQGTHFSSIPDAFWWAVVTMTTVGYGDMRPIT
VGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGSQSQGTGLDR
GGQRKASWNKGSFCKTVQGGSLDSGDSTRRGSCPLEKCNLKAKSNVDLRRSLYALCLDTS
RETDL
Download sequence
Identical sequences H0XJ31
ENSOGAP00000016121 ENSOGAP00000016121 XP_003796466.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]