SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016276 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000016276
Domain Number - Region: 41-133
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.00837
Family 2-methylcitrate dehydratase PrpD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016276   Gene: ENSOGAG00000033659   Transcript: ENSOGAT00000031098
Sequence length 153
Comment pep:novel scaffold:OtoGar3:GL873636.1:3148496:3148957:1 gene:ENSOGAG00000033659 transcript:ENSOGAT00000031098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGSRSHTSHMAPPASRAPQMRTAPRPAPAAQPPAAAPTYAVGSPTAAPWQPGLMAQMA
ATAAGVAVGSVVGHTLGYATTGGFSGGCNAEPSNPDITYQEPLGSQPAQQQQVGPCFCEM
KWLLECAQNQTDKKLCEGFNEVLKQCKLANRLS
Download sequence
Identical sequences H0XJI6
ENSOGAP00000016276 ENSOGAP00000016276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]