SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016323 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016323
Domain Number 1 Region: 295-600
Classification Level Classification E-value
Superfamily Kelch motif 1.26e-47
Family Kelch motif 0.00043
Further Details:      
 
Domain Number 2 Region: 12-126
Classification Level Classification E-value
Superfamily POZ domain 7.06e-31
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016323   Gene: ENSOGAG00000029042   Transcript: ENSOGAT00000027171
Sequence length 623
Comment pep:known_by_projection scaffold:OtoGar3:GL873620.1:1956389:2010977:1 gene:ENSOGAG00000029042 transcript:ENSOGAT00000027171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECKIQGKEKCQHSLDLLDKIKNMKELAEMVDVVLIAEEEKFPCHRLVLAAFSPYFKAMF
TCGLLECSQREVILHDITAESVSVILNYMYSAALEINNANVQTVAMAAYFMQMEEVFTIC
QKYMMDHMDASNCVGIYYFAKQIGAEDLSDQSKKYLYQHFAEVSLHEEILEIEVHQFLTL
IKSDDLNISREESILDLVLRWVNHNQELRTEHLVELLKQVRLELINPAFLRQALKRNTML
LCDAGCIDIIQNAFKAIKAPQQHSPNLRYGMETTSLLLCVGNNSSGIRSRRRNYGDASFC
YDPVSQKTYYISSPKYGEGLGTVCTGVVMENNTIIVAGEASASKLSRQKNRNVEIYRYHD
RGNQFWEKLCTTEFRELYALGSVHNDLYVIGGQMKIKNQYLITNCVDKYSVERDSWKRVS
PLPVQLACHAVVTVNKKLYVLGGWTPQMDLPDEEPDRLSNKLLQYDPSQDQWRERAPMKY
SKYRFSAAVVNSEIYVLGGIGCVGRDKGQVRKCLDVVEIYNPDGDFWREGPPMPSPLLSL
RTNSTSAGAVDGKLYVCGGFHGADRHEVISKEILELDPWENQWNVVAIDVLMHDSYDVCL
VARMNPRDLIPPPSDLMEEGCEH
Download sequence
Identical sequences H0XJN3
ENSOGAP00000016323 ENSOGAP00000016323 XP_003796238.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]