SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016447 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016447
Domain Number 1 Region: 136-322
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.2e-51
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000285
Further Details:      
 
Domain Number 2 Region: 11-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 7.53e-38
Family DNA repair glycosylase, N-terminal domain 0.000000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016447   Gene: ENSOGAG00000034171   Transcript: ENSOGAT00000030278
Sequence length 345
Comment pep:known_by_projection scaffold:OtoGar3:GL873534.1:1370954:1382695:-1 gene:ENSOGAG00000034171 transcript:ENSOGAT00000030278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPEKQLWKQIMGHRTLASTPALWASIPCPLSELRLDLVLASGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLYCTVYRGDKGWVGRPTLEELEAVHEYFQLDVSLAQLYRHWGSVDSHF
KEVARKYQGVRLLRQDPIECLFSFICSSNNNITRITGMVERLCQAFGPRLIQLDDVTYYG
FPSLQALAGPEVEAHLRKLGLGYRARYVNASAQAILEEQGGQAWLQQLREIPYEEAHKAL
CSLPGVGTKVADCVCLMALDKPQAVPVDVHVWQIAQRDYSWHSTTSQAKGPSPQTNKELG
NFFRSLWGPYAGWAQAVLFSADLRQPHCAREPPAKRRKWSKGPEG
Download sequence
Identical sequences H0XK07
ENSOGAP00000016447 ENSOGAP00000016447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]