SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016704 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016704
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-51
Family Cold shock DNA-binding domain-like 0.000000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016704   Gene: ENSOGAG00000024358   Transcript: ENSOGAT00000029497
Sequence length 144
Comment pep:known_by_projection scaffold:OtoGar3:GL873533.1:26839991:26840425:1 gene:ENSOGAG00000024358 transcript:ENSOGAT00000029497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKNKGKGGKNRHRGKNENESEKRELVFKEDGQEYAQVIKMLANGRLEAMCFDGVKRLCH
IRGKLRKKVWINTSDIILVGLQDYQDNKADVILKYNADEARSLKAYRELPEHAKINETDT
FGPGDDDEIQSDDIGDDDEDIDEI
Download sequence
Identical sequences H0XKR4
ENSOGAP00000016704 ENSOGAP00000016704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]