SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016978 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016978
Domain Number 1 Region: 9-61,96-156
Classification Level Classification E-value
Superfamily POZ domain 1.57e-21
Family BTB/POZ domain 0.0049
Further Details:      
 
Domain Number 2 Region: 311-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000013
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 214-236,284-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000679
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000016978
Domain Number - Region: 692-755
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000111
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016978   Gene: ENSOGAG00000034491   Transcript: ENSOGAT00000028694
Sequence length 981
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:11896876:11900439:1 gene:ENSOGAG00000034491 transcript:ENSOGAT00000028694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMPPPAEVTDPSHAPAVLRQLNEQRLRGLFCDVTLIAGDTKFPAHRSVLAASSPFFREAL
LTSAPLPLPSVTGGSAPNPAATTAASSSSSSPPPASPPTSSPPRVLELPGVPAAAFSDVL
NFIYSARLALPGGGGDGAAVAEIGALGRRLGISRLQGLGEGGDAWVPPAPAPMATSQPED
DNFGPGPRPPAEWEGDRAEAQDPDLQSSLPRRSLPCPRCGKSFIHPKRLQTHEAQCRRGG
GTREATGLGAGDSGPGGPTGVDASALPPPVGFQGGPEHVVKVVGGHVLYVCAACERSYVT
LSSLKRHSNVHSWRRKYPCRYCEKVFALAEYRTKHEVWHTGERRYQCIFCWETFVTYYNL
KTHQRAFHGISPGLLASEKTPNGGYKPKLNTLKLYRLLPMRAAKRPYKTYSQGAPEGPLS
PSLNTPAPVAMPASPPLGPPPAPEPGPPPSVITFAHPAPSVIVHGGSSSGGVGGGPASTG
GSQTASVITYTAPPRPPKKREYPPPPPEPTATATPTSPATAAGPATATTTEEAKGRNPRA
GRTLTYTAKPVGGIGGGGGSPAGPGRGPSQLQAPPPLCQITVRIGEEAIVKRRISETDLR
PGELSGEEVEESEDDEEDDEDEDEEESKASGEDQLWRPYYSYKPKRKAGAAGSGSGLPRG
RRPPRWRQKLERRSWEETPAAESPAGRARIERRHRCGDCAQTFATLRKLQKHQEAHSGGS
HSSRAGRRPSARLTCPHCAKVCKTAAALSRHEQRHAAERPGGTPTPVIAYSKGGAGTRPG
DIKEEAPQEMQVSSSSGEAGGGSAAAEEASETASLQDPVISGGEEPPVMAGGGSYAYPPV
QEFPLALIGGSREPGGGRGKSGSEGPGGANEGDRMEGMGAAKVTFYPEPYPLVYGPQLLA
AYPYNFSNLAALPVALNMVLPDEKGGGALPFLPGVFGYTVNPQAAAPTPLTPPPPTLPPP
VPPKGEGERAGLERTQTGDVG
Download sequence
Identical sequences H0XLI8
ENSOGAP00000016978 ENSOGAP00000016978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]