SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017048 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017048
Domain Number 1 Region: 1127-1266
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.96e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000165
Further Details:      
 
Domain Number 2 Region: 252-336
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000983
Family Calponin-homology domain, CH-domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017048   Gene: ENSOGAG00000029090   Transcript: ENSOGAT00000032513
Sequence length 1272
Comment pep:known_by_projection scaffold:OtoGar3:GL873821.1:466599:482049:1 gene:ENSOGAG00000029090 transcript:ENSOGAT00000032513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEAAPPGPGPLRRTFLVPEIKSLDQYDYSRAKAAASLAWVLRAAFGGAEHVPPELWEPF
YTDQYAQEHVKPPVTRLLLSAELYCRAWRQALPQLEIPPNPSALLALLARRGTVPSLPER
PVHEADLRHQPILMAAHLAVIDALMVVFAFEWTKTLPGPLALTSLEHKLLFWVDTTVRRL
QEKMEQEAAQRAPTDGTASSQPSCPTRWYWKLVPHAIAFCLKESGSKPPMIRYRKDRAVA
RRAPCFPTVTSIQDLASGAALAATIHCYCPQLLRLEEVCLKDPMSVADSLYNLQLVQDFC
ASHLPRGCPLSLEDLLYVPPPLKVNLVVLLAEMFMCFEVLKPDFVQAKDLPDGHAASPQG
TEASSSQNSGGGSSSPVFNFRHPLLSPGGPQSPLRGSTGSLKSSPSMSHMEALGKAWNRQ
LSRPLSQAVSFSTPFGLDSDVDVVMGDPVLLRSVSSDSLGPPRPVSARTPTQPLPESGDL
PTIEEALQIIHSAEPRLLPDGAADGSFYLHSPEGPCKPALASPYLPEGASKPLSDGPTKA
PIYLPHPEAPSKLSPCLVGEVSKTSAPSEGSPKAVPSSPAATNSDVKMTSFAERKKQLVK
AEAEAGAGSLMSNPAPPEALSSEMSELGARLEEKRRAIEAQKRRIEAIFAKHRQRLGKSA
FLQVQPREASGEADVEIESGSVPAGERPAGEGQGEPTSRPKSVTFSPELGPLPPEGLGEY
NRAVSKLSAALSSLQRDMQRLTDQQQRLLAPPEAPGPAPPPAAWVIPGPATGPKAASPSP
ARRAPATRRSPGPGPAPTPRSPKHARPAELRLTPLTRVLTPPHDVDSLPHLRKFSPSQVP
VQTRSSILLAEGPPPEEPAPRPGLIEIPLGSLQEPPTEDEGDGSPPGAEDSLEEEVSSEG
EPRAGLGFFYKDEDKPEDEMAQKRASLLERQQRRAEEARRRKQWQEAEKEQRREEAVRLA
QEEAPGPVPGALAAPSAALAPAPATRAPAEEDVGPRRGEFTRLEYERRAQLKLMDDLDKV
LRPRAAGAGGPGRGGRRAPRPRSGCCDDSALARSPARGLLGSRLSKIYSQSTLSLSTVAN
EAPNNLGVKRPTSRAPSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPS
AKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSG
ETEELSRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKK
PTTPKKGGGTPK
Download sequence
Identical sequences H0XLQ8
ENSOGAP00000017048 ENSOGAP00000017048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]