SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017228 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017228
Domain Number 1 Region: 291-547
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-56
Family Voltage-gated potassium channels 0.00098
Further Details:      
 
Domain Number 2 Region: 93-197
Classification Level Classification E-value
Superfamily POZ domain 2.46e-31
Family Tetramerization domain of potassium channels 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017228   Gene: ENSOGAG00000025777   Transcript: ENSOGAT00000024257
Sequence length 773
Comment pep:known_by_projection scaffold:OtoGar3:GL873730.1:453014:465954:1 gene:ENSOGAG00000025777 transcript:ENSOGAT00000024257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSVCVSSFRGRQGASKQQPAPPLQPPESPPLLPPPLPSAPLQQQQPAQPGSAASPAGP
PAPHGPGGQRAEPCPGLPAAAMGRHGGGGGDSGKIVINVGGVRHETYRSTLRTLPGTRLA
GLTEPEAAARFDYDPGADEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWG
IDETDVEACCWMTYRQHRDAEEALDSFEAPDPAGAANAANAAGAHEGGLDDEAGAGGGGL
DGAGGELKRLCFQDAGGGAGGPPGGAGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFA
SLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVEGVC
VVWFTFEFLMRITFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRV
VRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAD
PDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPV
PVIVNNFGMYYSLAMAKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPPHPHHGSGGIS
PPPPITPPSMGVTVAGAYPPGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEVIE
INRADPRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAP
SPDGSIRKGYEKSRSLSSIAGLSGVSLRLAPLATPPGSPRAARRAPPTLPSIL
Download sequence
Identical sequences H0XM88
ENSOGAP00000017228 ENSOGAP00000017228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]