SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017379 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017379
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 6.15e-21
Family Ribosomal protein L39e 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017379   Gene: ENSOGAG00000024799   Transcript: ENSOGAT00000034224
Sequence length 51
Comment pep:known_by_projection scaffold:OtoGar3:GL873605.1:2430304:2430459:1 gene:ENSOGAG00000024799 transcript:ENSOGAT00000034224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNKTFRIKRFLAKKQKQNRPVPQWIQMKTGNKIWYNSKRRHWRRTKLGL
Download sequence
Identical sequences H0XMN8
ENSOGAP00000017379 ENSOGAP00000017379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]