SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017416 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017416
Domain Number 1 Region: 306-575
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-67
Family Kelch motif 0.000045
Further Details:      
 
Domain Number 2 Region: 23-142
Classification Level Classification E-value
Superfamily POZ domain 3.18e-32
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017416   Gene: ENSOGAG00000026263   Transcript: ENSOGAT00000029032
Sequence length 589
Comment pep:known_by_projection scaffold:OtoGar3:GL873548.1:9908039:9909808:-1 gene:ENSOGAG00000026263 transcript:ENSOGAT00000029032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSVHETRKSRSSTGSMNVTLFHKASHPDCVLAHLNTLRKHRMFTDVTLWAGDRAFPCH
RAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENAESL
LEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFEAVR
QSEDFNSLSKDTLLDLISSDELETEDERVVFGAILQWVKHDPEQRKAHLPELLRRVRLAL
LPSDWLQEAVSGEALLVADERTRLIVDEALRCKTRILQNDGVVTSPCARPRKAGHTLLIL
GGQTFMCDKIYQVDHKAKEIIPKADLPSPRKEFSASAIGCKVYVTGGRGSENGVSKDVWV
YDTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPG
ANKWTMVAPLRDGVSNAAVVSAKLKLFVFGGTSIHRDMVSKVQCYDPSENRWTIKAECPQ
PWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKL
YVVGGYFGTQRCKTLDCYDPTSDTWNCITTVPYSLIPTAFVSTWKHLPA
Download sequence
Identical sequences H0XMS5
XP_003788699.1.62490 ENSOGAP00000017416 ENSOGAP00000017416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]