SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017797 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017797
Domain Number 1 Region: 327-594
Classification Level Classification E-value
Superfamily Kelch motif 6.41e-55
Family Kelch motif 0.00038
Further Details:      
 
Domain Number 2 Region: 18-127
Classification Level Classification E-value
Superfamily POZ domain 1.29e-30
Family BTB/POZ domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017797   Gene: ENSOGAG00000031234   Transcript: ENSOGAT00000030448
Sequence length 619
Comment pep:known_by_projection scaffold:OtoGar3:GL873601.1:4164104:4170395:1 gene:ENSOGAG00000031234 transcript:ENSOGAT00000030448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLGLEQAEEQRLYQQTLLQDGLKDMLDHGKFLDCVVRVGEREFPCHRLVLAACSPYFRA
RFLAEPESTGELRLEEVSPDVVAQVLNYLYTSEISLDEASVQDLFAAAHRFQIPSIFTIC
VSFLQKRLCLSNCLAVFRLGLLLDCARLAVAARDFICAHFTLVARDADFLGLSADELIAI
ISSDGLNVEKEEAVFEAVMRWAGSGDAEAQAERQRALPTVFESVRCRLLPRTFLETRVER
HPLVRAQPELLRKVQMVKDAHEGRITMLRKKKKGKEAAGAKEADKSTAEAKENEEDECVL
PGILNDTLRFGMFLQDLIFMISEEGAVAYDPAANECYCASLSNQVPKNHVSLVTKENQVF
VAGGLFYNEDNKEDPMSAYFLQFDHLDSEWLGMPPLPSPRCLFGLGEALNSIYVVGGREI
KDDERCLDSVLCYDRLSFKWGESDPLPYAVYGHAVLSHMDLVYVVGGKGSDRKCLKKMCV
YDPKKFEWKELAPMQTARSLFGATIHDGRIFVVAGVTDTGLTSSAEVYSIADNKWAPFEA
FPQERSSLSLVSLAGTLYALSGFATLETESGELVPTELNDIWRYNEDEKKWEGVLREIAY
AAGATFLPVRLNVLRLTKM
Download sequence
Identical sequences H0XNV6
ENSOGAP00000017797 ENSOGAP00000017797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]