SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017962 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017962
Domain Number 1 Region: 10-180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.88e-37
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000017
Further Details:      
 
Domain Number 2 Region: 192-319
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.84e-23
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017962   Gene: ENSOGAG00000025218   Transcript: ENSOGAT00000027222
Sequence length 319
Comment pep:novel scaffold:OtoGar3:GL873525.1:25396049:25397700:1 gene:ENSOGAG00000025218 transcript:ENSOGAT00000027222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HNLFLKSVTSALDNSLAKDPCIAKDPFGKDANFSRVFRCTVGLRDKDGKDRVFNTPLCEQ
GIVFGIGIAVTGATATAEIQFADDIFPASDQIVNLAAKYHYHSGDLFNCGSLTTWSPWGC
VDHKGLHHSQSPEAFFTHCPGIKVVISRSPFQAQVLLLSCREHKNPCFFEPKIPYKAAVE
QVPVEPYTLSLVEVIQEGSDVTLVAWSPQVHGIWEVTSMPKENLRMSCEIIDLRTIPPWD
VGTVCKSVIKTGCLFIVEAPLTRRFAWEISATVQECFLNLEAPISRVCEYGTPFPHIFEP
FHIPDKWKCYDALQKIINY
Download sequence
Identical sequences H0XPC1
ENSOGAP00000017962 ENSOGAP00000017962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]