SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017978 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017978
Domain Number 1 Region: 1-242
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.8e-74
Family N-type ATP pyrophosphatases 0.0000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017978   Gene: ENSOGAG00000027208   Transcript: ENSOGAT00000028388
Sequence length 267
Comment pep:known_by_projection scaffold:OtoGar3:GL873574.1:6315010:6315813:-1 gene:ENSOGAG00000027208 transcript:ENSOGAT00000028388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVAALISGGKDSCYNMMQCVAAGHQIVALANLRPAENEEGSDELDSYMYQTVGHHAIDL
YAEAMALPLYRRTIRGRSLDTGQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSD
YQRIRVENVCKRLNLQPLAYLWQRNQEDLLQEMISSNIQAIIIKVAALGLDPDKHLGKTL
DQMEPYLLELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYL
RFLELHLEDKVSPVPDNYRTSNYIHNS
Download sequence
Identical sequences H0XPD7
XP_003792311.1.62490 ENSOGAP00000017978 ENSOGAP00000017978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]