SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018144 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018144
Domain Number 1 Region: 358-534,569-735
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.21e-80
Family YicI catalytic domain-like 0.00026
Further Details:      
 
Domain Number 2 Region: 1230-1429,1474-1636
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.32e-77
Family YicI catalytic domain-like 0.00025
Further Details:      
 
Domain Number 3 Region: 113-357
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.48e-49
Family YicI N-terminal domain-like 0.0078
Further Details:      
 
Domain Number 4 Region: 981-1227
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-44
Family YicI N-terminal domain-like 0.0074
Further Details:      
 
Domain Number 5 Region: 1638-1718
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 9.35e-19
Family Putative glucosidase YicI, domain 3 0.01
Further Details:      
 
Domain Number 6 Region: 738-818
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.65e-17
Family Putative glucosidase YicI, domain 3 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018144   Gene: ENSOGAG00000026892   Transcript: ENSOGAT00000027085
Sequence length 1861
Comment pep:known_by_projection scaffold:OtoGar3:GL873568.1:2995990:3059597:-1 gene:ENSOGAG00000026892 transcript:ENSOGAT00000027085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKFTTLEIVLSVLLLVLFIVAVSLIVVLAKDSTKSTGITPDPGTTGTPDPGTTRTPD
SGTTARPGPGTTAKPGPGTTGTPTTPGSADCPVVNESERVNCIPDQQPTKATCDQRGCCW
SPQGAASVPWCYYSKNHGYQMEGDTVSTNAGFTAQLKSLPSSSLFGNAVDKVLLTAEYQT
SNRFHFKLTDQSNARYEVPHEHVQPFNGNAAGSLTYNVTVSKQPFSIKVTRRSNNRVLFD
SSIGPILFADQFLQLSIRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNADGTNL
YGTQTFFLCLEDASGLSFGVFLMNSNAMEVTLQPTPAITYRTIGGILDFYVFLGNTPEQV
VQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMRKVVERNRAAQLPYDVQHADIDYMDE
RKDFTYDPVDFQGLPEFVKELHNNGQKFVLIMDPAISNNSSPSNPYGPYDRGSDLKIWVN
GSDGVTPLIGEVWPGKTVFPDYTNPNCAVWWAKEFELFYNQVEFDGIWIDMNEVSNFVDG
SVSGCSTSNLNYPPFTPRVLDGYLFIKTLCMDAVQHWGKQYDVHNLYGYSMAIATAEAVK
TVFPNKRSFIVTRSTFAGSGKFAAHWLGDNAATWNDLRWSIPGMLEFNLFGIPMVGPDIC
GYALDAPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPAAFGEGSLLLNSSRHYLNIRYTL
LPYLYTLFFHAHSRGDTVARPLLHEFYGDSNTWDVDRQFLWGPGLLITPVLDQGAQKVMA
YMPDAVWYDYETGERVKWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTEASRKNPLG
LIIALDENKEAKGELFWDDGETKVPDTVANKVYLLYEFSVTQNRLDMRISQSTYKDPNTL
AFTEIKILGIQEPRNITVKHNGVPSQASPTVTYDSNFQVAIITDIDLVLGEAYTVEWDVK
IRDEEKINCYPDENGVTEENCSARGCVWEASSSPGVPYCYFVNDLYSVGDIQYNSHGATA
DISLKSSPYTNAFPSTPVNSLRLQVTYHKNEMLQFKIYDPNNNRYEVPVPLNIPRVPSST
SEGQLYDVLIKKNPFGIEIRRKNTGTVIWDSQLLGFTFNDMFIRVSTRLPSTYLYGFGET
EHTAFRRDLNWHTWGMFSRDEPPGDKKNSYGVHPYYMGLEQDGSAHGVLLLNSNAMVSDV
TFQPLPGLTYRTTGGILDFYVFLGPTPELVTQQYTELIGRPVMVPYWALGFQLCRYGYKN
DSEIASLYDDMVAAQIPYDVQYSDIDYMERQLDFTLSPNFSGFPALINRMKADGMRVILI
LDPAISGNETQPYPAFLRGVEDDVFIRYPDDGGIVWGKVWPDYPGVVINASLDWDSQLEQ
YRAYVAFPDFFRNSTVKWWKREMEELYTNPQNPEKSLKFDGMWIDMNEPASFVNGAVPSG
CRDPTLNRPPYVPYLVSRDKGLSSKTLCMESQQILADGSTVRHYDVHSLYGWSQTRPTYE
AVQEVTGQRGIVITRSTFPSSGRWSGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGAD
ICGFFNDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWNATFEEISRRVLQTRYTI
LPYLYTLMHQAHTEGTTVVRPLLHEFVSDQVTWDIDGQFLLGPAFLVSPVLELNARNVTA
YFPRARWYDYYTGVDINARGEWKTLPASLDHINLHVRGGYILPWQEPALNTHLSRQKFIG
FKVALDDNETAEGWLFWDDGQSIDTYEKGLYYWAKFSVSQNVMRSHVIFNNYILGTNPLK
LGYIEIWGVGSVPIANVSISVSGTVTALPFKNNSTMQVLSIDVTSSSISLHNFISLTWNT
L
Download sequence
Identical sequences H0XPV3
ENSOGAP00000018144 ENSOGAP00000018144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]