SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018164 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018164
Domain Number 1 Region: 37-164
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 6.54e-31
Family MaoC-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018164   Gene: ENSOGAG00000029128   Transcript: ENSOGAT00000034767
Sequence length 168
Comment pep:novel scaffold:OtoGar3:GL873534.1:29445299:29445805:-1 gene:ENSOGAG00000029128 transcript:ENSOGAT00000034767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPIIAIHRLWWAGLRRRVCLNQPVLNRQPCQRMRVKVGDRAELSRAFTHRDVATFSELT
GDVNPLHLNEDFAKHTKFGKTIVHGVLINGLISALLGTKMPGPGCVFLSQEINFPAPLYI
GEVVLASAEVKKLKRFIAVIEVSCSVIESRKTVMEGWVKVMVPEIPKS
Download sequence
Identical sequences H0XPX3
ENSOGAP00000018164 ENSOGAP00000018164 XP_012658020.1.62490 XP_012658021.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]