SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018189 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018189
Domain Number 1 Region: 113-217
Classification Level Classification E-value
Superfamily FKBP-like 3.34e-20
Family FKBP immunophilin/proline isomerase 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018189   Gene: ENSOGAG00000029509   Transcript: ENSOGAT00000028853
Sequence length 218
Comment pep:known_by_projection scaffold:OtoGar3:GL873521.1:37410574:37411498:-1 gene:ENSOGAG00000029509 transcript:ENSOGAT00000028853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVPQWVWAAEQLRSELLPKKEIIKFLQDHGSDSFPAEPKLLGNIKNVAKTANKDHSV
TAYNHLLETKRFKDTGSVSKVSEQVKNVKLSEDKPKETVYECPLKYTKSISKKEDKTNLL
QKGDVFCWYTGTLQDGTVFDTDIQTSSKKKKNAKPLSCLFFFFELHSAIDEALLTMSNLE
KAQLEMEPEWAYGRKGQPDAKIPPNAELIFEVELMDID
Download sequence
Identical sequences H0XPZ8
ENSOGAP00000018189 ENSOGAP00000018189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]