SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018489 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018489
Domain Number 1 Region: 34-240
Classification Level Classification E-value
Superfamily Heme oxygenase-like 5.64e-50
Family Eukaryotic type heme oxygenase 0.00000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018489   Gene: ENSOGAG00000027481   Transcript: ENSOGAT00000028299
Sequence length 292
Comment pep:novel scaffold:OtoGar3:GL873530.1:17677049:17677986:1 gene:ENSOGAG00000027481 transcript:ENSOGAT00000028299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQCQLKWRVEGVEESEKKNSWAAERENHSRMADLSELQKEGTKEAHDKAENIQFVKDFLK
GNIKKELFKLATTALYFTYSALEEEIEKEALTKDLEYFFGENWEERVQCSEAAQKYMDQI
HYIGQNEPELLVAYEYTCYMDLSGQVLKKVAQRAPKFPSTGEGTPFYLFENVDNAQQFKQ
FYQARMNALDLNLKTKERIVEAANKAFQYNIQIFNELDQAGSTLAIKTLEDGLPVHDGKG
DVRKCPYYIAQQDKGALEGSSCPFPTAMAMLRKPSLQFILAIDVALAAGFSA
Download sequence
Identical sequences H0XQU7
ENSOGAP00000018489 ENSOGAP00000018489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]