SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018675 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018675
Domain Number 1 Region: 15-125
Classification Level Classification E-value
Superfamily POZ domain 3.77e-23
Family BTB/POZ domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018675   Gene: ENSOGAG00000032899   Transcript: ENSOGAT00000030113
Sequence length 291
Comment pep:known_by_projection scaffold:OtoGar3:GL873721.1:659349:667235:-1 gene:ENSOGAG00000032899 transcript:ENSOGAT00000030113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLGLVVRGEAAPFSTALRSLINNPWYSDVRFVVGQERQEIFAHRCLLACRCSFFQRLL
GSEPGSRVESAVVLSTVPAETFLAVLEFLYTNSVKLYRHSVLEVLTAAVEYGLEELRELC
LEFVVKVLDVELVCEALQVAVTFGLGPLQECCIAFIEAHSQEALRTRGFLELSAPALLPL
LRSDKLCVDEAELVRAARSWARVGAAVLERPLAEVAAPVVRELRLALLAPAELSALEEQN
RREPLIPVEQIVEAWKCHALRRGDEVRGTPCRRRRGTLPREHHRFLDLPFK
Download sequence
Identical sequences H0XRD3
XP_003801239.1.62490 ENSOGAP00000018675 ENSOGAP00000018675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]