SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018820 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018820
Domain Number 1 Region: 298-580
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-51
Family Kelch motif 0.0014
Further Details:      
 
Domain Number 2 Region: 29-145
Classification Level Classification E-value
Superfamily POZ domain 3.53e-32
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018820   Gene: ENSOGAG00000024533   Transcript: ENSOGAT00000030418
Sequence length 601
Comment pep:known_by_projection scaffold:OtoGar3:GL873534.1:20276077:20286828:-1 gene:ENSOGAG00000024533 transcript:ENSOGAT00000030418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASADLSKCSPTPNGIPSSDTANDAMDPLHACSILKQLKTMYDEGQLTDIVVEVDHGKT
FSCHRNVLAAISPYFRSMFTSGLTESTQKEVRIVGVEAESMDLVLNYAYTSRVILTEANV
QALFTAASIFQIPSIQDQCAKYMISHLDPQNSIGVFIFADHYGHQELGDRAKEYIRKKFL
CVTKEQEFLQLTKDQLISILDSDDLNVDREEHVYESIIRWFEHEQNEREVHLPEIFAKCI
RFPLMEDTFIEKIPPQFAQAIAKCCVEKGPSNTNGCTQRLGMTASEMIICFDAAHKHSGK
KQTVPCLDIVTGRVFKLCKPPNDLREVGILVSPDNDIYIAGGYRPSSSEVSIDHKAENDF
WMYDHSTNRWLPKPSLLRARIGCKLVFCCGKMYAIGGRVYEGDGRNSLKSVECYDSRENC
WTTVCAMPVAMEFHNAVEYKEKIYVLQGEFFLFYEPQKDYWGFLTPMTVPRIQGLAAVYK
DSIYYIAGTCGNHQRMFTVEAYDIELNKWTRKKDFPCDQSINPYLKLVLFQNKLHLFVRA
TQVTVEEHVFRTSRKNSLYQYDDIADQWMKVYETPDRLWDLGRHFECAVAKLYPQCLQKV
L
Download sequence
Identical sequences H0XRS8
ENSOGAP00000018820 XP_003785561.2.62490 ENSOGAP00000018820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]