SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019101 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019101
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily POZ domain 3.82e-23
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 443-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 540-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 498-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 405-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 346-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000305
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 315-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000104
Family Classic zinc finger, C2H2 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019101   Gene: ENSOGAG00000028389   Transcript: ENSOGAT00000030445
Sequence length 710
Comment pep:known_by_projection scaffold:OtoGar3:GL873655.1:5395254:5402146:1 gene:ENSOGAG00000028389 transcript:ENSOGAT00000030445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGAVLLESKSSPLNLLHEMHELRLLGHLCDVTVSVEYQGVREDFVAHKAVLAATSKFF
KEMFLNDKSMDGARTNVYLNEVQVVDFASFLEFVYTAKVQVEEDRVQRMLEMAEKLKCLD
LSETCFQLKKQMLESVLLELQNFSESQEAEAGSGSQVSVGPGSRASGATEGLHSNGLVEP
SATPVERVSNGVSSDTLLRKPKEKLDKKREGVKPPYPKIRRASGRLAGRKVFVEIPKKKY
TRRLREQQNSIEDELGDDRCLQEQSSDSVGAEGESVEKNEGCCAEAQVKEVLQKAGVEEE
EEEEEDEEGEKKRSNFKCTICDKAFLYEKSFLKHSKHHHGVATEVVYRCDTCSQTFANRC
NLKSHQRHVHSSERHFPCELCGKKFKRKKDVKRHVVQVHEGGGERHRCGQCGKGLSSKTA
LRLHERTHTGDRPYACTECGAKFSQPSALKTHMRIHTGEKPFVCDECGARFTQNHMLIYH
RRCHTGERPFMCETCGKSFASKEYLKHHNRIHTGSKPFKCEVCFRTFAQRNSLYQHIKVH
TGERPYCCDQCGKQFTQLNALQRHRRIHTGERPFMCNACGRTFTDKSTLRRHTSIHDKNT
PWKSFLVIVDGSPKNDEGHKTEQPDEEYMAPKLSDKLLSFVENSHFHNLATVQGTVSTIH
ENSSADTACKSDNSAVSQDTLLTTTISELSELAPQTDSVSTQLHPLTNME
Download sequence
Identical sequences H0XSK9
ENSOGAP00000019101 ENSOGAP00000019101 XP_003798524.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]