SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019157 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019157
Domain Number 1 Region: 284-570
Classification Level Classification E-value
Superfamily Kelch motif 4.18e-66
Family Kelch motif 0.00017
Further Details:      
 
Domain Number 2 Region: 11-128
Classification Level Classification E-value
Superfamily POZ domain 1.96e-32
Family BTB/POZ domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019157   Gene: ENSOGAG00000012781   Transcript: ENSOGAT00000012786
Sequence length 581
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:6744140:6751640:1 gene:ENSOGAG00000012781 transcript:ENSOGAT00000012786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGSPDGLLFKDHGFSSDLLRQLNALRQSRILTDVSICTGAQEVPCHRNVLASSSPYFQ
AMFCGSFRENREAKVQLKGINAPTLEQIVCYVYTGEVYIASENVLPLMEAASMLQYPKLF
EACSSYLQGQLAPSNCLGMLRLSEILSCQTLKKKAREVALTHFPEVAASADLKELCALEL
RDYLSDDGLCGEEEKVFEALMAWIKHDLQARKQYVQELFKQVRLQYIHPAFFHHFIANDT
LLQSSPACRTILEMARRQVFSLYGTCAPDCKPLLHIPPRNSYQDFLILLGGRKDSQQTTR
DVLLYNRLTDQWQSLPQLPARLYKPSAITLHRSVYVLGGMAVSSGRSLVSHSVYIFSLKL
NQWRLGEPMLVARYSHRSTAHKNFIFSIGGLGEGQELMGSVERYDSVFNIWERMASMPVG
VLHPAVAVKDQRLYLFGGEDIMQNPVRLIQVYHISRNTWFKMETRMIKNVCAPAVVLGER
IVIVGGYTRRILAYDPQSNKFVKCADMKDRRMHHGATVMGNKLYVTGGRRLTTDCNIEDS
ASFDCYDPETDTWTSQGQLPHTLFDHACLTLQCIPHVSTLP
Download sequence
Identical sequences H0XSR5
XP_003782409.1.62490 ENSOGAP00000019157 ENSOGAP00000019157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]