SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019242 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019242
Domain Number 1 Region: 111-235
Classification Level Classification E-value
Superfamily POZ domain 4.32e-28
Family BTB/POZ domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019242   Gene: ENSOGAG00000033451   Transcript: ENSOGAT00000030355
Sequence length 538
Comment pep:known_by_projection scaffold:OtoGar3:GL873802.1:386097:388131:-1 gene:ENSOGAG00000033451 transcript:ENSOGAT00000030355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPLACLHGRVAQCLTALLVLAEPPPKPRRGARVCGAAPLCAEAAPAALPAKMAADLYP
PARAAAATDIANSNAAAAGSKASPRSPPRAPAPAPPPPAPVPPTPCNNNAESPNWQSCHP
TLRERNALMFNSELMADVHFVVGPLGATRRVPAHKYVLAVGSSVFYAMFYGDLAEVKSEI
HIPDVEPTAFLILLKYMYSDEIELEADTVLATLYAAKKYIVPALAKACVNFLETSLEAKN
ACVLLSQSRLFEEPELTQRCWEVIDAQAEMALRSEGFCEIDRQTLEIILTREALNTKEAV
VFEAVLHWAEAECKRQGLPVTPRNKRHVLGRALYLVRIPTMTLEEFANGAAQSDILTLEE
THHIFLWYTAANKPRLDFPLTKRKGLAPQRCHRFQSSAYRSNQWRYRGRCDSIQFAVDRR
VFIAGLGLYGSSSGKAEYSVKIELKRLGLVLAQNLTKFVSDGSSNTFSVWFEHPVQVEQD
SFYTASAVLDGSELSYFGQEGMTEVQCGKVTFQFQCSSDSTNGTGVQGGQIPELIFYA
Download sequence
Identical sequences H0XT00
ENSOGAP00000019242 XP_003803213.1.62490 ENSOGAP00000019242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]