SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019260 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019260
Domain Number 1 Region: 12-125
Classification Level Classification E-value
Superfamily POZ domain 2.43e-26
Family BTB/POZ domain 0.00062
Further Details:      
 
Domain Number 2 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 354-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.68e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 277-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000167
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019260   Gene: ENSOGAG00000009683   Transcript: ENSOGAT00000009683
Sequence length 448
Comment pep:known_by_projection scaffold:OtoGar3:GL873572.1:214765:216111:-1 gene:ENSOGAG00000009683 transcript:ENSOGAT00000009683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYF
KKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLD
KLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGT
PPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALTF
NDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTA
DRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPF
ACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPS
AIQSETEQLQAAAMAAEAEQQLETIACS
Download sequence
Identical sequences D2HQW1 G7NKD8 G7PWF0 H0XT18
ENSAMEP00000021069 ENSOGAP00000019260 ENSAMEP00000021069 9600.ENSPPYP00000010129 ENSOGAP00000019260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]