SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019267 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019267
Domain Number 1 Region: 170-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-47
Family Voltage-gated potassium channels 0.00089
Further Details:      
 
Domain Number 2 Region: 11-121
Classification Level Classification E-value
Superfamily POZ domain 2.09e-24
Family Tetramerization domain of potassium channels 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019267   Gene: ENSOGAG00000031627   Transcript: ENSOGAT00000032912
Sequence length 436
Comment pep:known_by_projection scaffold:OtoGar3:GL873543.1:963050:1017499:-1 gene:ENSOGAG00000031627 transcript:ENSOGAT00000032912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFGRSGAASVVLNVGGARYSLSRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNE
YFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRM
SDTYTFYSADEPGLLGRDEARPGGAEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVF
VIVSMVVLCASTLPDWRAAAADNRSLDDRSRYSAVPGREPSGIIEAICIGWFTAECIVRF
IISKNKCEFVKRPLNIIDLLAITPYYISVLMTVFTGENSQLQRAGVTLRVLRMMRIFWVI
KLARHFIGLQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDLETSNKDFASI
PAACWWVIISMTTVGYGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELK
FRSVRCSRSLSAEFLN
Download sequence
Identical sequences H0XT25
ENSOGAP00000019267 XP_003787922.1.62490 ENSOGAP00000019267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]