SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019326 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019326
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily POZ domain 3.92e-31
Family BTB/POZ domain 0.0009
Further Details:      
 
Domain Number 2 Region: 608-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000072
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019326   Gene: ENSOGAG00000012980   Transcript: ENSOGAT00000012980
Sequence length 676
Comment pep:known_by_projection scaffold:OtoGar3:GL873533.1:1079944:1097202:-1 gene:ENSOGAG00000012980 transcript:ENSOGAT00000012980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQ
TMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKACKHYLT
TRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALSSSQGGEEQPAPMSSSMRSNLD
QRTAFPMRRLHKRKQSAEERARQRLRPSMDESAISDVTPENGPSGVHSREEFFSPDSLKI
VDNPKADGMTDNQEDSAIMFDQSFGAQEDAQVPSQSDNSAGNMPQLSMASRATQVETSFD
QETATEKSSFQCENPEVGLGEKEHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEG
VVVSAEKIDLSPESSDRSFSDPQSTTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGSN
FSANQNNDDNIPNTTSDCRLEGEAPYLLSPESGPAGGPSSAPGSHVENPFSEPADSHFVR
PMQEVMGLPCVQTSGYQGEQFGMDFSRSGLGLHSSFSRVMIGSPRGGASNFPYYRRIAPK
MPVVTSVRSSQIPENSASSQLMMNGATSSFDNGHPSQPGPPQLTRASADVLSKCKKALSE
HNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHSK
TTCLRWQSSNLPSTLL
Download sequence
Identical sequences H0XT84
ENSOGAP00000019326 XP_012657877.1.62490 ENSOGAP00000019326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]