SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019327 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019327
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily POZ domain 8.24e-29
Family BTB/POZ domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019327   Gene: ENSOGAG00000024802   Transcript: ENSOGAT00000024438
Sequence length 583
Comment pep:known_by_projection scaffold:OtoGar3:GL873606.1:1731957:1769112:-1 gene:ENSOGAG00000024802 transcript:ENSOGAT00000024438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFS
GNSKSAFELPGSVPPACFQQILSFCYTGRLTMTASEQLVVMYTAGFLQIQHIIERGTDLM
FKVSSPHCDSQTAVIEETSSAPQSPCNQLQPTAATPYAASPSMPLPLLARVKHEAVELPP
AAGLGLAPKRPLETGPRDGVATGAAVAAGVAPLKLPRVSYYGVPGLATLIPGMQQAPYPQ
GERASPGASSLPATDSPTSYHNEEDEEDDEAYDTMVEEQYGQVYIKASGSYAVQEKPEPV
PLESRSCVLIRRDLVALPASLISQIGYRCHPKLYSEGDPGEKLELVAGSGVYITRGQLMN
CHLCAGVKHKVLLRRLLATFFDRNTLANSCGTGIRSSTSDPSRKPLDSRVLNAVKLYCQN
FAPSFKESEMNVIAADMCTNARRVRKRWLPKIKSMLPEGVEMYRTVMGASAASVPLDAEF
PPTAAQVFEQRIYAERRSDAATIVALRTDAMNVDLSATNPAFEAGEEVDGAGSVIQEVAA
PEPLPADGQSPHQPFEQGSTSSSRPQTPVATARRPEGTYAGTL
Download sequence
Identical sequences H0XT85
ENSOGAP00000019327 XP_003794886.1.62490 ENSOGAP00000019327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]