SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019702 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019702
Domain Number 1 Region: 62-368
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.15e-97
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000000000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019702   Gene: ENSOGAG00000030453   Transcript: ENSOGAT00000032835
Sequence length 380
Comment pep:known_by_projection scaffold:OtoGar3:GL873656.1:1933071:1934246:1 gene:ENSOGAG00000030453 transcript:ENSOGAT00000032835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKMLAAFVSRVRSSVVQKPARRVLVASYNYSNDATFDIKKCDRYLLEQGPPVSAVLTRQ
DRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGIS
VRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYQGNKEIC
LTLYGDGAANQGQIAEAFNMAALWKLPCIFICENNLYGMGTSIERAAASTDYYKRGGFIP
GLRVDGMDFLCVREATKFAADYCRSGKGPFLMELQTYRYHGHSMSDPGISYRTREEIKNI
RSKSDPIMLLQDKMVNSKLATVEELKEIEAEVRKEIEDAAQFATADSEPPLEEIGHHIFS
SEPPFEVRGANPWIKFKSIS
Download sequence
Identical sequences H0XUB0
ENSOGAP00000019702 ENSOGAP00000019702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]