SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020126 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020126
Domain Number 1 Region: 88-198
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.06e-36
Family Frataxin-like 0.000000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020126   Gene: ENSOGAG00000031105   Transcript: ENSOGAT00000029036
Sequence length 211
Comment pep:novel scaffold:OtoGar3:GL873525.1:27110507:27135337:1 gene:ENSOGAG00000031105 transcript:ENSOGAT00000029036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLGRRAAAGLLPRWALPGPAQAFTPAPRPAESAQLCCRRGLRAGTSAARAPRYASLNL
HCLNQILNVKKQRVYLMNLRKSGTLGEPGSLDDTTYERLAEETLDSLAEFFEDLADKPYT
FEDYDVSFGSGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDG
VSLHELLAAELTKALKTKVDLSSLAYSGKGP
Download sequence
Identical sequences H0XVI4
ENSOGAP00000020126 ENSOGAP00000020126 XP_003783094.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]