SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020260 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020260
Domain Number 1 Region: 45-152
Classification Level Classification E-value
Superfamily POZ domain 2.67e-24
Family BTB/POZ domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020260   Gene: ENSOGAG00000033069   Transcript: ENSOGAT00000028412
Sequence length 224
Comment pep:novel scaffold:OtoGar3:GL873526.1:14469966:14485650:-1 gene:ENSOGAG00000033069 transcript:ENSOGAT00000028412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RATLSSLQNEVISQQLCVIFTHCYGPYPIPKLTEIKRKQTSRLDPHFLNNKEMSDVTFLV
EGRPFYAHKVLLFTASPRFKALLSSKPTNDSTCIEIGYVKYPIFQLVMQYLYYGGPESLL
IKNNEIMELLSAAKFFQLEALQRHCEIICAKSINTDNCVDIYNHAKKSIWTNSLYQEESP
VSLKGPGPPSWPRALKLPREPDIHKWHFRDLPPWSKGWCSKIPP
Download sequence
Identical sequences H0XVW7
ENSOGAP00000020260 ENSOGAP00000020260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]