SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020307 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020307
Domain Number 1 Region: 335-537
Classification Level Classification E-value
Superfamily Kelch motif 8.37e-30
Family Kelch motif 0.0016
Further Details:      
 
Domain Number 2 Region: 45-170
Classification Level Classification E-value
Superfamily POZ domain 9.94e-27
Family BTB/POZ domain 0.0027
Further Details:      
 
Domain Number 3 Region: 569-635
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000085
Family Kelch motif 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020307   Gene: ENSOGAG00000034361   Transcript: ENSOGAT00000026273
Sequence length 684
Comment pep:novel scaffold:OtoGar3:GL873537.1:22308198:22316151:1 gene:ENSOGAG00000034361 transcript:ENSOGAT00000026273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAAAGSAGLAAEVRGSGTVDFGPGPGISAMEASGGDPGPEAEDFECSSHCSELSWRQNEQ
RRQGLFCDITLCFGGAGGREFRAHRSVLAAATEYFTPLLSGQFSESRSGRVEMRKWSSEP
GPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELADRFLLIRLKEFCGEFLKFLKKKLHLSN
CVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQDEEFYTLPFHLIRDWLSDLEITVDSEE
VLFETVLKWVQRNAEERERYFEELFKLLRLSQMKPTYLTRHVKPERLVANNEVCVKLVAD
AVERHALRAENIQSATFQHPASHVSLLPRFGQNMDVIMVIGGVSEGGDYLSECVGYFVDE
DRWVNLPHIHNHLDGHAVAVTESYVYVAGSMEPGFAKTVERYNPNLNTWEHVCSLMTRKH
SFGLTEVKGKLYSIGGHGNFSPGFKDVTVYNPELDKWHNLESAPKILRDVKALAIEDRFV
YIAARTPVDRDTEDGLKAVITCYDTETRQWQDVESLPLIDNYCFFQMSVVNSNFYQTASC
CPKSYSLENEEAVRKIASQVSDEILESLPPEVLSIEGAAICYYKDDVFIIGGWKNSDDID
KQYRKEAYRYCAERKRWMLLPPMPQPRCRATACHVRIPYRYLHGTQRYPMPQNLMWQKDR
IRQMQEIHRHALNMRRVPSSQIEC
Download sequence
Identical sequences H0XW14
ENSOGAP00000020307 ENSOGAP00000020307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]