SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020429 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020429
Domain Number 1 Region: 36-109
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-21
Family Linker histone H1/H5 0.0000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020429   Gene: ENSOGAG00000027950   Transcript: ENSOGAT00000025886
Sequence length 213
Comment pep:known_by_projection scaffold:OtoGar3:GL873548.1:18384206:18384847:-1 gene:ENSOGAG00000027950 transcript:ENSOGAT00000025886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETAPAAPAAAPSVEKAPVKKKATKKPAGARRKASGPPVSELITKAVAASKERSGVSLA
ALKKALAAVGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAAAGEAKPKA
KKAGAAKPKKPAGAAKKPKKATGAATPKKSAKKTPKKAKKPAAAAVTKKVAKSPKKAKVA
KPKKAAKSAAKTVKPKAAKPKVVKPKKAAPKKK
Download sequence
Identical sequences H0XWD6
ENSOGAP00000020429 ENSOGAP00000020429 XP_003788828.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]